PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G290400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 260aa    MW: 28628.9 Da    PI: 10.2563
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G290400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-162469147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        rg W + Ed++l ++v+ +G+ +W++Ia+++  gR++k+c++rw++ 
  Sevir.7G290400.1.p 24 RGHWRPGEDDKLRQLVENYGPQNWNSIAEKLE-GRSGKSCRLRWFNQ 69
                        899*****************************.***********996 PP

2Myb_DNA-binding56.18.5e-1876120147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r ++T+ E+e+l++a++ +G++ W++I+r ++ gRt++ +k++w+ +
  Sevir.7G290400.1.p  76 RRPFTAAEEERLLQAHRAHGNR-WALISRLFP-GRTDNAVKNHWHVV 120
                         679*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7311970IPR017930Myb domain
SuperFamilySSF466897.86E-2922117IPR009057Homeodomain-like
SMARTSM007176.6E-132372IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-262577IPR009057Homeodomain-like
CDDcd001675.17E-132768No hitNo description
PfamPF139214.4E-162787No hitNo description
PROSITE profilePS5129426.04471125IPR017930Myb domain
SMARTSM007172.2E-1575123IPR001005SANT/Myb domain
CDDcd001672.16E-1278121No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2078123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MAPSSSTTAT PVRANSRPPS SCPRGHWRPG EDDKLRQLVE NYGPQNWNSI AEKLEGRSGK  60
SCRLRWFNQL DPRINRRPFT AAEEERLLQA HRAHGNRWAL ISRLFPGRTD NAVKNHWHVV  120
MARRSHHHHR SAGTLALLAG SVYSPPPRRP PFQCFHFGAP PAAMKTTGSL SLCFATPGSG  180
PSSSLSSPGT FSVIRNCNVP TTVAFSSSRE VAATPDDHRH DMGRDDHGHR KDDDEDGDGT  240
ASKRKDVDVP FFDFLGVGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-30241244104MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-30241244104C-Myb DNA-Binding Domain
1msf_C1e-30241244104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9724981e-105EU972498.1 Zea mays clone 382267 myb-like DNA-binding domain containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978299.10.0PREDICTED: transcription factor MYB44-like
TrEMBLK3YC471e-175K3YC47_SETIT; Uncharacterized protein
STRINGSi011791m1e-174(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.16e-60myb domain protein 52